PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000759G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 316aa    MW: 34759.3 Da    PI: 6.0886
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000759G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072662992154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  PH01000759G0180 266 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 299
                      469*****************************87 PP

2ELK27.76.3e-10220241122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +L++++++++g++++E++
  PH01000759G0180 220 ELKIELKQGFKSRIGDVREEIL 241
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-145498IPR005540KNOX1
PfamPF037901.7E-135696IPR005540KNOX1
SMARTSM012564.7E-24109164IPR005541KNOX2
PfamPF037918.9E-19112163IPR005541KNOX2
SMARTSM011880.0049220241IPR005539ELK domain
PfamPF037892.2E-6220241IPR005539ELK domain
PROSITE profilePS512139.289220240IPR005539ELK domain
PROSITE profilePS5007111.693240303IPR001356Homeobox domain
SMARTSM003894.9E-10242307IPR001356Homeobox domain
SuperFamilySSF466895.56E-16242306IPR009057Homeodomain-like
CDDcd000867.05E-12243304No hitNo description
Gene3DG3DSA:1.10.10.604.9E-25247306IPR009057Homeodomain-like
PfamPF059201.1E-17260299IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQGGDQGGGS LGMDMGVGFT GSVGGGECSS SSATAAVAAA AAAAAAAAEA EERQLLKGEM  60
AVHPLCEQLV AAHVGCLRVA TPIDHLPLID AQLSQSSGLL HSYAAHHRAF LSPHDKQELD  120
SFLAQYLMLL CSFREQLQQH VRVHAVEAVM ACREIEQSLQ DLTGATLEEG TGATMSEDEE  180
EPQIMDGAMD MGSDGHDMMG FGPLLPTDSE RSLMERVRQE LKIELKQGFK SRIGDVREEI  240
LRKRRAGKLP GDTTTILKQW WQQHSKWPYP TEDDKAKLVE ETGLQLKQIN NWFINQRKRN  300
WHNNSQTSTL KSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296315RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1004270.0FP100427.1 Phyllostachys edulis cDNA clone: bphyem121o22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150419.10.0homeobox protein HD1
SwissprotQ94LW30.0KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLA0A0E0K8450.0A0A0E0K845_ORYPU; Uncharacterized protein
STRINGGRMZM2G159431_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-127KNOTTED-like homeobox of Arabidopsis thaliana 7